Skip to content

Lean-Mean-Protein-Machine-Learning/LMPM

Folders and files

NameName
Last commit message
Last commit date

Latest commit

 

History

183 Commits
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

Repository files navigation

Lean Mean Protein Machine!

Build Status Coverage Status

Table of Contents
  1. Project Overview
  2. Dependencies
  3. Getting Started
  4. Usage
  5. License
  6. Contact

Project Overview

Structure-based design of proteins shows great promise in nanoparticle vaccines. However, one of the major hurdles to function and use of designed nanoparticles is sub-optimal secretion. In this project, we have analyzed proteins in three different organisms (humans, yeast, and E. Coli) to correlate subcellular location to genetically encodable features. We have also added an option of extending this model to include transmembrane potential, percent of secondary structure helices, and flexibility of amino acids. These models predict the probability of a protein being in the secreted class. We have also added a function to introduce point mutations into a designed protein to improve the secretion score.

Dependencies

  1. Pandas
    • Data-organization framework
  2. Numpy
    • Numerical operations
  3. Scikit-Learn
    • Supervised machine learning models
  4. Matplotlib
    • Data Visualization in python
  5. Seaborn
    • High-level interface for attractive graphics

Getting Started

Using the web app:

We have deployed our machine learning model as a web app hosted on Heroku. It is by far the most intuitive way to use it and offers nearly all the functionality of the module. Please, check it out at https://lmpm.herokuapp.com/.

Since we are using free Heroku hosting, you may reach the memory limit. An easy alternative is running the web app locally, so that it acts as a user interface for the module. For that you need a working Docker installation and running the following commands:

git clone https://github.com/Lean-Mean-Protein-Machine-Learning/LMPM.git
cd LMPM
docker build -t lmpm_web .
docker run -d -it -p 5000:5000 --name lmpm_image lmpm_web

Building the docker image will take 30 seconds and about 500 Mb of disk space. Then the app will be live and perfectly functional on your browser at http://localhost:5000/.

Using as a module:

Using lmpm as a Python module offers more versatility than the web app and facilitates integrating its functions into an automated pipeline/workflow. For that, you only need a Python environment with the lmpm dependencies (see "Dependencies" section above) installed. Optionally, you can set up a new conda environment for this module by downloading our environment.yml file and creating it:

# install miniconda (if required)
wget https://repo.anaconda.com/miniconda/Miniconda3-latest-Linux-x86_64.sh
bash Miniconda3-latest-Linux-x86_64.sh

# download environment specification file
wget https://raw.githubusercontent.com/Lean-Mean-Protein-Machine-Learning/LMPM/main/environment.yml

# create "lmpmenv" environment from this file
conda env create -f environment.yml

# activate environment
conda activate lmpmenv

With an environment with the required dependencies, you can then install the lmpm module with:

python3 -m pip install git+https://github.com/Lean-Mean-Protein-Machine-Learning/LMPM

For developers:

For more details on how to use the module or contribute, check our docs/get_started.md file.

Usage

First, import the module:

import lmpm

Alternatively, the six main functions can be imported individually:

from lmpm import predict_loc_simple
from lmpm import predict_location
from lmpm import optimize_sequence
from lmpm import plot_optimization
from lmpm import top_mutations

Predict protein localization

The localization probability of the protein (according to the model) can be predicted using predict_loc_simple. The function needs the user to specify a sequence, the desired organism, and the localization of interest (secreted, membrane, or cytoplasm):

sequence = 'MKPNIIFVLSLLLILEKQAAVMGQKGGSKGRLPSEFSQFPHGQKGQHYSG'
organism = 'human'
target_location = 'secreted'
predicted_class, secretion_score = predict_loc_simple(sequence, organism, target_location, include_dg=False)

The localization and probabilities of the protein can also be predicted using the more versatile function predict_location. This can be expanded to all organisms and returns the results as a class with multiple attributes:

sequence = 'MKPNIIFVLSLLLILEKQAAVMGQKGGSKGRLPSEFSQFPHGQKGQHYSG'
organism = 'human'
target_location = 'all'
predictions = predict_location(sequence, organism, target_location, include_dg=False)
predictions.result

Make point mutations in sequence to improve desired localization

Point mutations can be introduced in a sequence to investigate their effects on protein localization. First, the optimize_sequence function takes in the sequence, organism, desired localization, and the positions for desired point mutations. Note that only one point mutation occurs at a time. The mutated_scores variable below returns a data frame of amino acids vs. the locations for point mutations and the values of the localization scores (as the probability of the protein belonging to the desired localization class).

sequence = 'MKPNIIFVLSLLLILEKQAAVMGQKGGSKGRLPSEFSQFPHGQKGQHYSG'
organism = 'human'
target_location = 'cytoplasm'
positions = '4,9'
mutated_scores, initial_score = optimize_sequence(sequence, organism, target_location, include_dg=False, positions=positions)

The outputs of this function can be represented using the plot_optimization function. This takes as inputs the results returned by the optimize_sequence function:

plot_optimization(mutated_scores, initial_score, plot_inplace=True, dpi=100)

Finally, the top_mutations function takes the results from the optimize_sequence function and returns the top mutations that change the localization score. The example below shows the top 10 results from the optimization function:

top_mutations(mutated_scores, initial_score, top_results=10)

A more informative demo notebook is available under docs/lmpm_demo.ipynb

License

This project is licensed under the MIT license.

Contribute

Lean, Mean, Protein Machine is a completely functional module but can offer much more.

  • If you have an idea and want to implement it, clone our repo and initite a pull request.
  • If you find any issue using our module, open a Github issue here, we will try to fix it.
  • Finally, if you like the project and would like to contribute but don't have a specific idea in mind, contact us! We have many ideas in mind on how the project could advance and about new functions that could be added to extend its functionality.

Contact

About

No description, website, or topics provided.

Resources

License

Stars

Watchers

Forks

Releases

No releases published

Packages

 
 
 

Contributors

Languages